Vergleich

IRS1 Rabbit pAb Europäischer Partner

ArtNr A16902-50ul
Hersteller Abclonal
Menge 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NCBI IRS1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HIRS-1, IRS1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
This gene encodes a protein which is phosphorylated by insulin receptor tyrosine kinase. Mutations in this gene are associated with type II diabetes and susceptibility to insulin resistance.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (NP_005535.1).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:100
Protein Size
132kDa
Route
Recombinant Protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Protein phosphorylation, Cancer, Signal Transduction, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, MAPK-Erk Signaling Pathway, MAPK-JNK Signaling Pathway, Cell Biology Developmental Biology, Growth factors, Endocrine Metabolism, Insulin Receptor Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Immunology Inflammation, Neuroscience, Cell Type Marker, Cardiovascular, Heart, Cardiovascular diseases, Heart disease

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen