RPL4 Rabbit pAb

ArtNr	A5886-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKL
NCBI	RPL4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	L4, uL4, RPL4
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RPL4 (NP_000959.2).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	48kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A5886-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern