Vergleich

RBMS3 Rabbit pAb Europäischer Partner

ArtNr A17142-20ul
Hersteller Abclonal
Menge 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence MDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
NCBI RBMS3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RBMS3
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 334-433 of human RBMS3 (NP_001171183.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
48kDa
Route
Recombinant Protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen