Comparison

Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein European Partner

Item no. RP00479-500ug
Manufacturer Abclonal
Amount 500 ug
Quantity options 1000 ug 100 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE;> 95% by HPLC
NCBI Fc gamma RIIB/CD32b
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc gamma RII,Fc gamma RIIB,CD32,CD32b,CDw32,FCG2,IGFR2,CD32A,FCG2 ,FcGR,FCGR2,FCGR21,FCGR2A
Similar products IFNA2, LeIF A, Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
22.5 kDa
Description
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala46-Pro217) of Human Fc gamma RIIB/CD32b (Accession #P31994-1) fused with a C-His&Avi tag at the C-terminus.
Background
The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala46-Pro217
Route
C-His&Avi
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Revised name
Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
Antigen Seq
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
22.5 kDa
Gene Symbol
Fc gamma RIIB/CD32b

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close