Comparison

Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant

Manufacturer Angio-Proteomie
Category
Type Proteins Recombinant
Specific against other
Amount 2ug
Item no. ANG-rAP-2111-2ug
Targets VEGFA
eClass 6.1 34160400
eClass 9.0 42020190
Available
Description
Product Name: Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant
Synonyms: FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1.
Description: FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques.
Uniprot Accesion Number: P17948
Amino Acid Sequence:SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY.
Source: Insect Cells.
Physical Appearance and Stability: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution FLT1 should be stored at 4° C between 2-7 days and for future use below -18° C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. Greater than 90.0% as determined by SDS-PAGE.
Application:
Solubility: It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells.
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close