Vergleich

Pramlintide

ArtNr ANG-rAP-2580-1mg
Hersteller Angio-Proteomie
Menge 1 mg
Quantity options 1 ea 1 mg 25 mg 5 mg
Kategorie
Typ Proteins
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Description: Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.
Amino Acid Sequence:KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.
Physical Appearance and Stability: Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Pramlintide should be stored at 4C between 2-7 days and for future use below -18C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: The protein was lyophilized with no additives. Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MO-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen