Vergleich

M1-linkage Specific Polyubiquitin Rabbit pAb Europäischer Partner

ArtNr A18200-20ul
Hersteller Abclonal
Menge 20 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Primary
Applikationen WB, ELISA, Dot
Specific against other
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NCBI UBB
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Other Modified Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Ubiquitination, onetypeofthemostcommonpost-translationalmodification, mediatestheregulationofproteinhomeostasisinvivo. Substrate proteins can be modified with single ubiquitin moieties or with polymeric ubiquitin chains. Within polyubiquitin chains, ubiquitin can form eight different linkage types, using one of seven internal lysine residues (K6, K11, K27, K29, K33, K48, K63) or methionine at position 1 (M1).Here we focus on a distinct type of ubiquitination that is characterized by an inter-ubiquitin linkage through the N-terminal methionine, called M1-linked or linear ubiquitination. Formation, recognition, and disassembly of linear ubiquitin chains are highly specific processes that are implicated in immune signaling, cell death regulation and protein quality control. Consistent with their role in influencing signaling events, linear ubiquitin chains are formed in a transient and spatially regulated manner, making their detection and quantification challenging.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.1).
Recommended Dilution
WB, 1:500 - 1:2000|DB, 1:500 - 1:1000
Route
Synthetic peptide

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen