Vergleich

SPRY2 Rabbit pAb Europäischer Partner

ArtNr A1855-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVH
NCBI SPRY2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IGAN3, hSPRY2, SPRY2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SPRY2 (NP_005833.1).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200
Protein Size
35kDa
Route
Synthetic peptide
Manufacturer - Research Area
Signal Transduction, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Neuroscience, Stem Cells, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen