ArtNr |
A19754-100ul |
Hersteller |
Abclonal
|
Menge |
100 ul |
Quantity options |
1000 uL
100 ul
200 ul
20 ul
500 uL
50 ul
|
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human (Homo sapiens) |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH |
NCBI |
SGCA |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
ADL, DAG2, 50DAG, DMDA2, LGMD2D, LGMDR3, SCARMD1, adhalin, alpha Sarcoglycan (SGCA) |
Similar products |
ADL, DAG2, DMDA2, LGMD2D, SCARMD1, adhalin, 50DAG |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Category |
Monoclonal Antibodies |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Background |
This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586). |
Recommended Dilution |
WB, 1:100 - 1:500|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
43kDa |
Route |
Synthetic Peptide |
Manufacturer - Research Area |
Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Extracellular Matrix |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.