« Zurück
Home /
Cleaved PARP (Asp214) Rabbit pAb

Cleaved PARP (Asp214) Rabbit pAb

ArtNr	A22535-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
NCBI	Parp1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PARP, PPOL, ARTD1, Adprp, Adprt1, msPARP, parp-1, sPARP-1, 5830444G22Rik, Cleaved PARP (Asp214)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background	Enables NAD+ ADP-ribosyltransferase activity; chromatin binding activity; and protein ADP-ribosylase activity. Involved in negative regulation of telomere maintenance via telomere lengthening; positive regulation of single strand break repair; and voluntary musculoskeletal movement. Acts upstream of or within several processes, including DNA metabolic process; behavioral response to cocaine; and protein poly-ADP-ribosylation. Located in cytoplasm; nucleolus; and nucleoplasm. Part of protein-containing complex. Is expressed in several structures, including Peyer's patch; brain; gut; immune system; and retina. Human ortholog(s) of this gene implicated in several diseases, including arthritis; bacterial meningitis; neurodegenerative disease (multiple); stomach carcinoma; and type 2 diabetes mellitus. Orthologous to human PARP1 (poly(ADP-ribose) polymerase 1).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 201-300 of Mouse PARP (Asp214) (NP_031441.2).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	113kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, other, DNA Damage & Repair, RNA Binding, Signal Transduction, Cell Biology & Developmental Biology, Cell Cycle, Centrosome, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 12.06.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail