Vergleich

Cleaved PARP (Asp214) Rabbit pAb Europäischer Partner

ArtNr A22535-50uL
Hersteller Abclonal
Menge 50 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
NCBI Parp1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PARP,PPOL,ARTD1,Adprp,Adprt1,msPARP,parp-1,sPARP-1,5830444G22Rik,Cleaved PARP (Asp214)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
113kDa
Background
Enables NAD+ ADP-ribosyltransferase activity; chromatin binding activity; and protein ADP-ribosylase activity. Involved in negative regulation of telomere maintenance via telomere lengthening; positive regulation of single strand break repair; and voluntary musculoskeletal movement. Acts upstream of or within several processes, including DNA metabolic process; behavioral response to cocaine; and protein poly-ADP-ribosylation. Located in cytoplasm; nucleolus; and nucleoplasm. Part of protein-containing complex. Is expressed in several structures, including Peyer's patch; brain; gut; immune system; and retina. Human ortholog(s) of this gene implicated in several diseases, including arthritis; bacterial meningitis; neurodegenerative disease (multiple); stomach carcinoma; and type 2 diabetes mellitus. Orthologous to human PARP1 (poly(ADP-ribose) polymerase 1).
Manufacturer - Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 201-300 of Mouse PARP (Asp214) (NP_031441.2).
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
113kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, other, DNA Damage & Repair, RNA Binding, Signal Transduction, Cell Biology & Developmental Biology, Cell Cycle, Centrosome, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway.
Antigen Seq
AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
Expected Protein Size
113kDa
Gene Symbol
Parp1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 29.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen