Vergleich

ABflo® 594 Rabbit anti-Mouse IgG1 mAb Europäischer Partner

ArtNr A24926-200T
Hersteller Abclonal
Menge 200 T
Quantity options 100 T 100 ul 200 T 20 ul 500 T
Kategorie
Typ Antibody Monoclonal
Applikationen FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Purity Affinity purification
Sequence AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDIT
NCBI Ighg1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias IgG1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 594. Ex:594nm. Em:619nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
36kDa
Background
Mouse IgG1 is a subtype of immunoglobulin G antibody that is produced by B cells in response to an antigen. It is the most abundant IgG subtype in the serum and plays a crucial role in the adaptive immune response. Mouse IgG1 is composed of two heavy chains and two light chains, and it is involved in opsonization, complement activation, and antibody-dependent cell-mediated cytotoxicity. It is also involved in the regulation of immune responses, including the activation of T cells and the inhibition of B cell activation. Mouse IgG1 is widely used in research and diagnostic applications, including ELISA, Western blotting, and immunohistochemistry. It is also used in therapeutic applications, such as immunotherapy and vaccine development.
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 98-324 of mouse IgG1(P01868).
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
35kDa
Route
Recombinant Protein
Manufacturer - Research Area
Immunology Immunoglobulins Heavy Chain IgG.
Antigen Seq
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Expected Protein Size
36kDa
Gene Symbol
Ighg1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 T
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen