CXCL1 Rabbit mAb

ArtNr	A25014-100uL
Hersteller	Abclonal
Menge	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies Antibody
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NCBI	CXCL1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	KC,Fsp,N51,gro,Gro1,Mgsa,Scyb1,CXCL1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	10kDa
Background	This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-96 of mouse CXCL1(NP_032202.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	10kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology Developmental Biology, Growth factors, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Manufacturer - Gene ID (Human)	2919
Expected Protein Size	10kDa
Gene Symbol	CXCL1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A25014-100uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern