Vergleich

mCherry Rabbit pAb Europäischer Partner

ArtNr AE171-200uL
Hersteller Abclonal
Menge 200 uL
Quantity options 100 uL 200 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against other
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI mCherry
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias mCherry,mCherry tag,mCherry-tag
Lieferbar
Specificity Discosoma
Manufacturer - Category
Tag Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
Protein tags are peptide sequences genetically grafted onto a recombinant protein. Often these tags are removable by chemical agents or by enzymatic means, such as proteolysis or intein splicing. Tags are attached to proteins for various purposes.Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include V5-tag, Myc-tag, HA-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.
Manufacturer - Cross Reactivity
Species independent
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of mCherry tag.
Recommended Dilution
WB, 1:2000 - 1:6000
Route
Recombinant protein
Antigen Seq
MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Gene Symbol
mCherry

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen