« Zurück
Startseite /
Phospho-YAP1-S127 Rabbit mAb

Phospho-YAP1-S127 Rabbit mAb

ArtNr	AP1436-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies Antibody
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	LPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFL
NCBI	YAP1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	YAP1,COB1,YAP,YAP2,YAP65,YKI,Yes associated protein 1,Phospho-YAP1-S127
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Phosphorylated Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Background	This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic phosphorylated peptide around S127 of human YAP1(NP_001123617.1).
Recommended Dilution	WB, 1:1000 - 1:5000\|IF, 1:50 - 1:200
Protein Size	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Transcription Factors, Cancer, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology & Developmental Biology, Hippo Signaling Pathway.
Antigen Seq	RAHSSP
Manufacturer - Gene ID (Human)	10413
Expected Protein Size	36kDa/48kDa/49kDa/50kDa/52kDa/53kDa/54kDa
Gene Symbol	YAP1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

AP1436-20uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern