« Zurück
Startseite /
Phospho-CRKL-Y207 Rabbit pAb

Phospho-CRKL-Y207 Rabbit pAb

ArtNr	AP1452-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies Antibody
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	IPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNP
NCBI	CRKL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CRKL,Phospho-CRKL-Y207
Lieferbar
Manufacturer - Category	Phosphorylated Antibodies
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	34kDa
Background	This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.
Manufacturer - Cross Reactivity	Mouse
Immunogen	A synthetic phosphorylated peptide around Y207 of human CRKL (NP_005198.1) .
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	34kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, RNA Binding, Protein phosphorylation, Cancer, Signal Transduction, Kinase, MAPK-JNK Signaling Pathway, Immunology Inflammation, Neuroscience.
Antigen Seq	HAYAQP
Manufacturer - Gene ID (Human)	1399
Expected Protein Size	34kDa
Gene Symbol	CRKL

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

AP1452-20uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern