« Zurück
Startseite /
Recombinant Human Neurofilament light polypeptide (NEFL)

Recombinant Human Neurofilament light polypeptide (NEFL)

ArtNr	BM-RPC20744-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Neurodegeneration Markers
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTA RSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENL DLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIE RVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQ EIRDLRLAAEDATNEKQALQGEREGLEETLRNLQA RYEEEVLSREDAEGRLMEARKGADEAALARAELEK RIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVE MDV
Protein Familie	Intermediate filament family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	68KDA neurofilament protein Neurofilament triplet L protein
Similar products	68KDA neurofilament protein Neurofilament triplet L protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	64.9 kDa
Expression Region	2-543aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
Involvement in disease	Charcot-Marie-Tooth disease 1F (CMT1F); Charcot-Marie-Tooth disease 2E (CMT2E)
Function	Neurofilaments usually contain three intermediate filament proteins
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	NEFL
Sequence Information	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 11.09.2025