« Back
Home /
Recombinant Human Neurofilament light polypeptide (NEFL)

Recombinant Human Neurofilament light polypeptide (NEFL)

Item no.	BM-RPC20744-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Neurodegeneration Markers
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTA RSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENL DLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIE RVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQ EIRDLRLAAEDATNEKQALQGEREGLEETLRNLQA RYEEEVLSREDAEGRLMEARKGADEAALARAELEK RIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVE MDV
Protein Family	Intermediate filament family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	68KDA neurofilament protein Neurofilament triplet L protein
Similar products	68KDA neurofilament protein Neurofilament triplet L protein
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	64.9 kDa
Expression Region	2-543aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
Involvement in disease	Charcot-Marie-Tooth disease 1F (CMT1F); Charcot-Marie-Tooth disease 2E (CMT2E)
Function	Neurofilaments usually contain three intermediate filament proteins
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	NEFL
Sequence Information	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer