« Zurück
Startseite /
Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

ArtNr	BM-RPC20757-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYY DSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD PHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNL IPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEAL RCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIR TKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLR FNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLK DSL
Protein Familie	Glycosyltransferase 29 family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I
Similar products	B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2, 6-sialyltransferase 1 ST6Gal I
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	52.1 kDa
Expression Region	1-406aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Subcellular location	Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted
Function	Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	ST6GAL1
Sequence Information	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern