« Back
Home /
Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

Recombinant Human Beta-galactoside alpha-2,6-sialyltransferase 1 (ST6GAL1)

Item no.	BM-RPC20757-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYY DSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQD PHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNL IPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEAL RCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIR TKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLR FNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLK DSL
Protein Family	Glycosyltransferase 29 family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I
Similar products	B-cell antigen CD75 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2, 6-sialyltransferase 1 ST6Gal I
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	52.1 kDa
Expression Region	1-406aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Subcellular location	Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted
Function	Transfers sialic acid from CMP-sialic acid to galactose-containing acceptor substrates.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	ST6GAL1
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer