« Zurück
Startseite /
Recombinant Human Toll-like receptor 10 (TLR10), partial

Recombinant Human Toll-like receptor 10 (TLR10), partial

ArtNr	BM-RPC20760-50ug
Hersteller	Biomatik
Menge	50 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	DAPELPEERELMTNCSNMSLRKVPADLTPATTTLD LSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDL KTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDL SFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDF QKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLH IVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFV SYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQ FVW
Protein Familie	Toll-like receptor family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CD290
Similar products	CD_antigen: CD290
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	84.6 kDa
Expression Region	20-576aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity)
Subcellular location	Membrane, Single-pass type I membrane protein
Function	Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).
Activity	Not Tested
Tissue Specificity	Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	TLR10
Sequence Information	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 UG

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern