« Back
Home /
Recombinant Human Toll-like receptor 10 (TLR10), partial

Recombinant Human Toll-like receptor 10 (TLR10), partial

Item no.	BM-RPC20760-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	DAPELPEERELMTNCSNMSLRKVPADLTPATTTLD LSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDL KTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDL SFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDF QKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLH IVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFV SYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQ FVW
Protein Family	Toll-like receptor family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD_antigen: CD290
Similar products	CD_antigen: CD290
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	84.6 kDa
Expression Region	20-576aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity)
Subcellular location	Membrane, Single-pass type I membrane protein
Function	Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).
Activity	Not Tested
Tissue Specificity	Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	TLR10
Sequence Information	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer