« Zurück
Startseite /
Recombinant Mouse Acid ceramidase (Asah1), partial

Recombinant Mouse Acid ceramidase (Asah1), partial

ArtNr	BM-RPC20843-100ug
Hersteller	Biomatik
Menge	100 UG
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Sequence	QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINL DLPPYKRWHELLAQKAPALRILVNSITSLVNTFVP SGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTG IPLGEIISFNIFYELFTM
Protein Familie	Acid ceramidase family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Similar products	Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	33.8 kDa
Expression Region	19-141aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Subcellular location	Lysosome
Function	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	Asah1
Sequence Information	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 UG

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern