« Back
Home /
Recombinant Mouse Acid ceramidase (Asah1), partial

Recombinant Mouse Acid ceramidase (Asah1), partial

Item no.	BM-RPC20843-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Sequence	QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINL DLPPYKRWHELLAQKAPALRILVNSITSLVNTFVP SGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTG IPLGEIISFNIFYELFTM
Protein Family	Acid ceramidase family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Similar products	Acylsphingosine deacylase N-acylsphingosine amidohydrolase
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	33.8 kDa
Expression Region	19-141aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Subcellular location	Lysosome
Function	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	Asah1
Sequence Information	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer