Vergleich

Anti-MSH6 Antibody Europäischer Partner

ArtNr BOS-A00553-1
Hersteller Boster
Menge 100 ug/vial
Kategorie
Typ Antibody Primary
Format Lyophilized
Applikationen WB
Specific against other
Host Rabbit
Isotype IgG
Citations 1. Kariola, R., Raevaara, T. E., Lonnqvist, K. E., Nystrom-Lahti, M. Functional analysis of MSH6 mutations linked to kindreds with putative hereditary non-polyposis colorectal cancer syndrome. Hum. Molec. Genet. 11: 1303-1310, 2002.
2. Verma, L., Kane, M. F., Brassett, C., Schmeits, J., Evans, D. G. R., Kolodner, R. D., Maher, E. R. Mononucleotide microsatellite instability and germline MSH6 mutation analysis in early onset colorectal cancer. J. Med. Genet. 36: 678-682, 1999.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DNA mismatch repair protein Msh6
Lieferbar
Specificity No cross reactivity with other proteins.
Storage Conditions
At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Clonality
Polyclonal
Manufacturer - Gene Name
MSH6
Gene Full Name
Mediator of RNA polymerase II transcription subunit 1
Background
MSH6 or mutS homolog 6 is a gene that codes for DNA mismatch repair protein Msh6 in the budding yeast Saccharomyces cerevisiae. This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
Immunogen
A synthetic peptide corresponding to a sequence of human MSH6 (DDSSRPTVWYHETLEWLKEEKRRDEHRRRPDH).
Contents
Each vial contains 4 mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Protein Name
DNA mismatch repair protein Msh6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.