« Zurück
Startseite /
Recombinant Chicken Syntaxin-6(STX6),partial

Recombinant Chicken Syntaxin-6(STX6),partial

ArtNr	CSB-EP022902CH-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIA TREEIDWTTNELRNNLRSIEWDLEDLDETISIVEA NPRKFNLDATELGIRKSFITSTRQVVREMKDQMSN SSMQALAERKNRQALLGESSSQSWSSGPDKYSRLD RELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGS IGVLKNMSQRIGGELEEQAVMLDDFSHELDSTHSR LDNVMKKLAKVSHMTSDR
Protein Familie	Syntaxin family
Citations	Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis.Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P., Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P., Hayashizaki Y., Buerstedde J.-M.Genome Biol. 6:R6.1-R6.9(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	30.1 kDa
Relevance	Involved in intracellular vesicle trafficking.
Expression Region	4-231aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in intracellular vesicle trafficking.
Subcellular Location	Golgi apparatus membrane, Single-pass type IV membrane protein
Gene Names	STX6
Sequence Info	Partial
Organism	Gallus gallus (Chicken)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP022902CH-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern