Vergleich

Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)

ArtNr CSB-AP005141HU-1
Hersteller Cusabio
Menge 1 mg
Quantity options 1 mg 10 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized powder
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGG QRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFH CLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQ KRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPA DLSPGASSVTPPAPAREPGHSPQ
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA
Lieferbar
Manufacturer - Category
Drug Target / Immune Checkpoint
Manufacturer - Conjugate / Tag
C-terminal 6xHis-tagged
Molecular Weight
18.1 kDa
General Research Areas
Cancer
Relevance
Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL).
Function
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Subcellular Location
Membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed on the surface of activated T-cells.
Gene Names
TNFRSF9
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Expression Region
24-186aa
Protein Description
Extracellular Domain
Biological Activity
The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 28.08.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen