Vergleich

Recombinant Human Ephrin type-A receptor 8(EPHA8),partial

ArtNr CSB-AP005581HU-50
Hersteller Cusabio
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Konjugat/Tag Fc
Purity Greater than 95% as determined by SDS-PAGE.
Sequence ARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDE SFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRV YAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRD LGASTQESQFLKIDTIAADESFTGADLGVRRLKLN TEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYK KCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHS EERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDA CVA
Protein Familie Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ephrin type-A receptor 8;EEK; HEK3; KIAA1459;EPHA8;Tyrosine-protein kinase receptor EEK;hEK3;EK3;EPH-like kinase 3;EPH- and ELK-related kinase
Lieferbar
Manufacturer - Category
Other Recombinant Protein / Others
Manufacturer - Conjugate / Tag
C-terminal FC-tagged
Molecular Weight
78.4 kDa
General Research Areas
Signal Transduction
Relevance
Ephrin type-A receptor 8 (EPHA8) is single-pass type I membrane protein. As receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth.
Function
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. With EFNA5 may regulate integrin-mediated cell adhesion and migration on fibronectin substrate but also neurite outgrowth. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth (By similarity).
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Cell projection, Early endosome membrane
Gene Names
EPHA8
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Expression Region
28-495aa
Protein Description
Partial
Biological Activity
The ED50 as determined by its ability to bind Mouse Ephrin-A5 in functional ELISA is less than 40 ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

 
Schließen