Comparison

Recombinant Human Ephrin type-A receptor 8(EPHA8),partial

Item no. CSB-AP005581HU-50
Manufacturer Cusabio
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Conjugate/Tag Fc
Purity Greater than 95% as determined by SDS-PAGE.
Sequence ARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDE SFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRV YAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRD LGASTQESQFLKIDTIAADESFTGADLGVRRLKLN TEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYK KCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHS EERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDA CVA
Protein Family Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ephrin type-A receptor 8;EEK; HEK3; KIAA1459;EPHA8;Tyrosine-protein kinase receptor EEK;hEK3;EK3;EPH-like kinase 3;EPH- and ELK-related kinase
Available
Manufacturer - Category
Other Recombinant Protein / Others
Manufacturer - Conjugate / Tag
C-terminal FC-tagged
Molecular Weight
78.4 kDa
General Research Areas
Signal Transduction
Relevance
Ephrin type-A receptor 8 (EPHA8) is single-pass type I membrane protein. As receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth.
Function
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. With EFNA5 may regulate integrin-mediated cell adhesion and migration on fibronectin substrate but also neurite outgrowth. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth (By similarity).
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Cell projection, Early endosome membrane
Gene Names
EPHA8
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Expression Region
28-495aa
Protein Description
Partial
Biological Activity
The ED50 as determined by its ability to bind Mouse Ephrin-A5 in functional ELISA is less than 40 ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

 
Close