« Zurück
Startseite /
Recombinant Human Alcohol dehydrogenase class-3(ADH5)

Recombinant Human Alcohol dehydrogenase class-3(ADH5)

ArtNr	CSB-EP001357HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVR IKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAG IVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNP KTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYM GTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGI STGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGC KVAGASRIIGVDINKDKFARAKEFGATECINPQDF SKP
Protein Familie	Zinc-containing alcohol dehydrogenase family, Class-III subfamily
Citations	cDNA sequence of human class III alcohol dehydrogenase.Sharma C.P., Fox E.A., Holmquist B., Joernvall H., Vallee B.L.Biochem. Biophys. Res. Commun. 164:631-637(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Alcohol dehydrogenase 5;Alcohol dehydrogenase class chi chain;Alcohol dehydrogenase class-III;Glutathione-dependent formaldehyde dehydrogenase (EC:1.1.1.-) ;FALDH ;FDH ;GSH-FDHS-(hydroxymethyl)glutathione dehydrogenase (EC:1.1.1.284)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	66.6 kDa
General Research Areas	Metabolism
Relevance	Class-III ADH is rarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione.
Expression Region	2-374aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione.
Subcellular Location	Cytoplasm
Gene Names	ADH5
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP001357HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025