« Zurück
Startseite /
Recombinant Human Interferon alpha/beta receptor 1(IFNAR1) ,partial

Recombinant Human Interferon alpha/beta receptor 1(IFNAR1) ,partial

ArtNr	CSB-EP011046HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	RWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNI TSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEV DSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGTKD SVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRH KIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIK TTVENELPPPENIEVSVQNQNYVLKWDYTYANMTF QVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCV FPQ
Citations	Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. SeattleSNPs variation discovery resourceThe DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokine receptor class-II member 1Cytokine receptor family 2 member 1 ;CRF2-1Type I interferon receptor 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 71, 8
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits thselves. Can also transduce IFNB signals without the help of IFNAR2, and not activating the Jak-STAT pathway.
Expression Region	48-436aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	IFNAR1
Sequence Info	Extracellular Domain
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025