« Zurück
Startseite /
Recombinant Human Pyruvate kinase isozymes R/L(PKLR)

Recombinant Human Pyruvate kinase isozymes R/L(PKLR)

ArtNr	CSB-EP018071HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGP AGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL EHLCLLDIDSEPVAARSTSIIATIGPASRSVERLK EMIKAGMNIARLNFSHGSHEYHAESIANVREAVES FAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEV ELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRV VPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGV LGS
Protein Familie	Pyruvate kinase family
Citations	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pyruvate kinase 1;Pyruvate kinase isozymes L/RR-type/L-type pyruvate kinaseRed cell/liver pyruvate kinase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	65.8 kDa
General Research Areas	Metabolism
Relevance	Plays a key role in glycolysis.
Expression Region	1-574aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a key role in glycolysis.
Involvement in disease	Pyruvate kinase hyperactivity (PKHYP); Pyruvate kinase deficiency of red cells (PKRD)
Paythway	Insulinsignalingpathway
Gene Names	PKLR
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018071HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern