« Zurück
Startseite /
Recombinant Human Threonine--tRNA ligase, mitochondrial(TARS2),partial

Recombinant Human Threonine--tRNA ligase, mitochondrial(TARS2),partial

ArtNr	CSB-EP023132HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLA LKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHR AEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQ SCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLW DQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVH LHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGAL ERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSP FQV
Protein Familie	Class-II aminoacyl-tRNA synthetase family
Citations	VARS2 and TARS2 mutations in patients with mitochondrial encephalomyopathies.Diodato D., Melchionda L., Haack T.B., Dallabona C., Baruffini E., Donnini C., Granata T., Ragona F., Balestri P., Margollicci M., Lamantea E., Nasca A., Powell C.A., Minczuk M., Strom T.M., Meitinger T., Prokisch H., Lamperti C., Zeviani M., Ghezzi D.Hum. Mutat. 35:983-989(2014)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Threonyl-tRNA synthetase ;ThrRSThreonyl-tRNA synthetase-like 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.3 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Expression Region	369-718aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the attachment of threonine to tRNA(Thr) in a two-step reaction
Subcellular Location	Mitochondrion matrix
Involvement in disease	Combined oxidative phosphorylation deficiency 21 (COXPD21)
Gene Names	TARS2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP023132HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern