Recombinant Human Alpha-enolase(ENO1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP023944h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P06733
Gene Names
ENO1
Organism
Homo sapiens (Human)
AA Sequence
SILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVP SGASTGIYEALELRDNDKTRYMGKGVSKAVEHINK TIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNS EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAA NFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDV AASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYK SFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVV GDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVT ESLQACKLAQANGWGVMVSHRSGETEDTFIADLVV GLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKA KFAGRNF
Expression Region
2-428aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
73.4 kDa
Alternative Name(s)
2-phospho-D-glycerate hydro-lyaseC-myc promoter-binding protein; Enolase 1MBP-1MPB-1Non-neural enolase ; NNEPhosphopyruvate hydratasePlasminogen-binding protein
Relevance
Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic syst due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
Reference
Molecular cloning and nucleotide sequence of a full-length cDNA for human alpha enolase.Giallongo A., Feo S., Moore R., Croce C.M., Showe L.C.Proc. Natl. Acad. Sci. U.S.A. 83:6741-6745(1986)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close