Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP053854h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transport |
Uniprot ID |
P19404 |
Gene Names |
NDUFV2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKN YPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEV LQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTP CMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEV ECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELK AGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFG VQAGL |
Expression Region |
35-249aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
50.6 kDa |
Alternative Name(s) |
NADH-ubiquinone oxidoreductase 24KDA subunit |
Relevance |
Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone . |
Reference |
Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). |
Subcellular Location |
Mitochondrion inner membrane |
Protein Families |
Complex I 24 kDa subunit family |
Paythway |
OxidativePhosphorylation |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.