« Zurück
Startseite /
Recombinant Human Intercellular adhesion molecule 1(ICAM1),partial

Recombinant Human Intercellular adhesion molecule 1(ICAM1),partial

ArtNr	CSB-RP071444h-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Signaling Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIET PLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCP DGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLT LRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPA EVTTTVLVRRDHHGANFSCRTELDLRPQGLELFEN TSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVC SLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSA KAS
Protein Familie	Immunoglobulin superfamily, ICAM family
Citations	ICAM, an adhesion ligand of LFA-1, is homologous to the neural cell adhesion molecule NCAM.Simmons D., Makgoba M.W., Seed B.Nature 331:624-627(1988)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Major group rhinovirus receptor; CD54
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	76.5 kDa
General Research Areas	Cell Adhesion
Relevance	ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagent promotes the assbly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
Expression Region	28-480aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.
Subcellular Location	Membrane, Single-pass type I membrane protein
Paythway	LipidsandInflammation inAtherogenesis
Gene Names	ICAM1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern