« Zurück
Startseite /
Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

ArtNr	CSB-RP081294h-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Neurodegeneration Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPG TYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQL CRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAW ALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPC KAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQ SDTTCKNPLEPLPPEMSGT
Citations	Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid.Baens M., Chaffanet M., Cassiman J.-J., van den Berghe H., Marynen P.Genomics 16:214-218(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III ;TNF-RIII ;TNFR-III
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	25.4 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Expression Region	31-224aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Subcellular Location	Membrane, Single-pass type I membrane protein
Paythway	HIF-1signalingpathway
Gene Names	LTBR
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-RP081294h-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern