« Zurück
Startseite /
Recombinant Human Chorionic somatomammotropin hormone protein(CSH1)

Recombinant Human Chorionic somatomammotropin hormone protein(CSH1)

ArtNr	CSB-RP113774h(A4)-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETY IPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQK SNLELLRISLLLIESWLEPVRFLRSMFANNLVYDT SDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILK QTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVET FLRMVQCRSVEGSCGF
Protein Familie	Somatotropin/prolactin family
Citations	"The human growth hormone locus: nucleotide sequence, biology, and evolution."Chen E.Y., Liao Y.C., Smith D.H., Barrera-Saldana H.A., Gelinas R.E., Seeburg P.H.Genomics 4:479-497(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lactogen; Placental lactogen; Short name:; PL
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	26.3 kDa
General Research Areas	Signal Transduction
Relevance	Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Expression Region	27-217aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Subcellular Location	Secreted
Paythway	Jak-STATsignalingpathway
Gene Names	CSH1
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.09.2025