« Zurück
Startseite /
Recombinant Human Protein-lysine 6-oxidase(LOX),partial

Recombinant Human Protein-lysine 6-oxidase(LOX),partial

ArtNr	CSB-RP169094h-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYF QYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEEN CLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFL PSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQR RVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLS PGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPS YLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Protein Familie	Lysyl oxidase family
Citations	Molecular cloning of human lysyl oxidase and assignment of the gene to chromosome 5q23.3-31.2.Haemaelaeinen E.-R., Jones T.A., Sheer D., Taskinen K., Pihlajaniemi T., Kivirikko K.I.Genomics 11:508-516(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lysyl oxidase
Lieferbar
Manufacturer - Targets	LOX
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	32.4 kDa
General Research Areas	Signal Transduction
Relevance	Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of Extracellular domain matrix proteins, may have a direct role in tumor suppression.
Expression Region	174-417aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin
Subcellular Location	Secreted, Secreted, extracellular space
Tissue Specificity	Heart, placenta, skeletal muscle, kidney, lung and pancreas.
Involvement in disease	Aortic aneurysm, familial thoracic 10 (AAT10)
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-RP169094h-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025