« Zurück
Startseite /
Recombinant Human 11-beta-hydroxysteroid dehydrogenase type 2(HSD11B2)

Recombinant Human 11-beta-hydroxysteroid dehydrogenase type 2(HSD11B2)

ArtNr	CSB-YP010765HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLL AALALLAALDWLCQRLLPPPAALAVLAAAGWIALS RLARPQRLPVATRAVLITGCDSGFGKETAKKLDSM GFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLT KPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVA DAELSPVATFRSCMEVNFFGALELTKGLLPLLRSS RGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDT FSC
Protein Familie	Short-chain dehydrogenases/reductases (SDR) family
Citations	Cloning and tissue distribution of the human 11 beta-hydroxysteroid dehydrogenase type 2 enzyme.Albiston A.L., Obeyesekere V.R., Smith R.E., Krozowski Z.S.Mol. Cell. Endocrinol. 105:R11-R17(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase ;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	46.1 kDa
General Research Areas	Cancer
Relevance	Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Expression Region	1-405aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Subcellular Location	Microsome, Endoplasmic reticulum
Tissue Specificity	Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071).
Involvement in disease	Apparent mineralocorticoid excess (AME)
Gene Names	HSD11B2
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP010765HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern