« Zurück
Startseite /
Recombinant Human Glycogen phosphorylase, liver form(PYGL),partial

Recombinant Human Glycogen phosphorylase, liver form(PYGL),partial

ArtNr	CSB-YP019122HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHL HFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRT QQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQ NACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLA ACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQ VEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTN TGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWS ARA
Protein Familie	Glycogen phosphorylase family
Citations	Sequence analysis of the cDNA encoding human liver glycogen phosphorylase reveals tissue-specific codon usage.Newgard C.B., Nakano K., Hwang P.K., Fletterick R.J.Proc. Natl. Acad. Sci. U.S.A. 83:8132-8136(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	98.9 kDa
General Research Areas	Metabolism
Relevance	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Expression Region	2-846aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Involvement in disease	Glycogen storage disease 6 (GSD6)
Paythway	Necroptosis
Gene Names	PYGL
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP019122HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern