« Zurück
Startseite /
Recombinant Mouse CD82 antigen(Cd82) ,partial

Recombinant Mouse CD82 antigen(Cd82) ,partial

ArtNr	CSB-EP004961MO-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQA QVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIK EEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGC MEKAQAWLQENF
Protein Familie	Tetraspanin (TM4SF) family
Citations	The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.5 kDa
Relevance	Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Expression Region	111-227aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Subcellular Location	Membrane, Multi-pass membrane protein
Tissue Specificity	Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.
Gene Names	Cd82
Sequence Info	Extracellular Domain
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004961MO-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern