Vergleich

Recombinant Human adenovirus C serotype 5 DNA-binding protein(DBP),partial

ArtNr CSB-BP365892HIL-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Konjugat/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLL PDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTM MGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEI EGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQ SSKAKIVKNRWGRNVVQISNTDARCCVHDAACPAN QFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNA QTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPF ALS
Protein Familie Adenoviridae E2A DNA-binding protein family
Citations "Mislocalization of the MRN complex prevents ATR signaling during adenovirus infection."
Carson C.T., Orazio N.I., Lee D.V., Suh J., Bekker-Jensen S., Araujo F.D., Lakdawala S.S., Lilley C.E., Bartek J., Lukas J., Weitzman M.D.
EMBO J. 28:652-662(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Early 2A protein (Early E2A DNA-binding protein) (DBP)
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
42.3 kDa
General Research Areas
Cancer
Relevance
Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Expression Region
174-529aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Subcellular Location
Host nucleus
Gene Names
DBP
Sequence Info
Partial
Organism
Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen