« Zurück
Startseite /
Recombinant Human Beta-2 adrenergic receptor(ADRB2)

Recombinant Human Beta-2 adrenergic receptor(ADRB2)

ArtNr	CSB-CF001392HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVG MGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFW CEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYR ATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNL SQV
Protein Familie	G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
Citations	"Structure of the gene for human beta 2-adrenergic receptor: expression and promoter characterization."Emorine L.J., Marullo S., Delavier-Klutchko C., Kaveri S.V., Durieu-Trautmann O., Strosberg A.D.Proc. Natl. Acad. Sci. U.S.A. 84:6995-6999(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-2 adrenoreceptor; Short name:; Beta-2 adrenoceptor
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	62.5 kDa
General Research Areas	Signal Transduction
Relevance	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Expression Region	1-413aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Subcellular Location	Cell membrane, Multi-pass membrane protein, Early endosome
Paythway	Calciumsignalingpathway
Gene Names	ADRB2
Sequence Info	Full Length of BC063486
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF001392HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern