« Zurück
Startseite /
Recombinant Human C-C chemokine receptor type 2(CCR2)

Recombinant Human C-C chemokine receptor type 2(CCR2)

ArtNr	CSB-CF004841HU-10
Hersteller	Cusabio
Menge	10 ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKF DVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANE WVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPG IIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVI FTI
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Monocyte chemoattractant protein 1 receptor; Short name:MCP-1-R ; CMKBR2
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Molecular Weight	45.4 kDa
General Research Areas	Cancer
Relevance	Receptor for the CCL2, CCL7 and CCL13 chemokines. Receptor for the beta-defensin DEFB106A/DEFB106B. Transduces a signal by increasing intracellular calcium ion levels. Upon CCL2 ligation, mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable).
Gene Names	CCR2
Endotoxin	Not test.
Storage Buffer	Tris-based buffer, 50% glycerol
Expression Region	1-374aa
Protein Description	Full Length
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CCR2 at 1 ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 41.51-83.15 ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF004841HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

nicht lieferbar