« Back
Home /
Recombinant Human C-C chemokine receptor type 2(CCR2)

Recombinant Human C-C chemokine receptor type 2(CCR2)

Item no.	CSB-CF004841HU-10
Manufacturer	Cusabio
Amount	10 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKF DVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANE WVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPG IIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVI FTI
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Monocyte chemoattractant protein 1 receptor; Short name:MCP-1-R ; CMKBR2
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Molecular Weight	45.4 kDa
General Research Areas	Cancer
Relevance	Receptor for the CCL2, CCL7 and CCL13 chemokines. Receptor for the beta-defensin DEFB106A/DEFB106B. Transduces a signal by increasing intracellular calcium ion levels. Upon CCL2 ligation, mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable).
Gene Names	CCR2
Endotoxin	Not test.
Storage Buffer	Tris-based buffer, 50% glycerol
Expression Region	1-374aa
Protein Description	Full Length
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CCR2 at 1 ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 41.51-83.15 ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF004841HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

not available