« Zurück
Startseite /
Recombinant Vaccinia virus Protein I5(VACWR074)

Recombinant Vaccinia virus Protein I5(VACWR074)

ArtNr	CSB-CF318298VAI-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VDAITVLTAIGITVLMLLMVISGAALIVKELNPND IFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATY VKSLLMKS
Protein Familie	Chordopoxvirinae I5 family
Citations	"Sequence and transcriptional analysis of the vaccinia virus HindIII I fragment."Schmitt J.F.C., Stunnenberg H.G.J. Virol. 62:1889-1897(1988)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein VP13K
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	24.6 kDa
Relevance	Envelope protein
Expression Region	2-79aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Envelope protein.
Subcellular Location	Virion membrane, Multi-pass membrane protein
Gene Names	VACWR074
Sequence Info	Full Length of Mature Protein
Organism	Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-CF318298VAI-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025