« Zurück
Startseite /
Recombinant Escherichia coli Outer membrane protein A(ompA)

Recombinant Escherichia coli Outer membrane protein A(ompA)

ArtNr	CSB-CF364256ENV(A4)-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQL GAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENG AYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRAD TKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLE YQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEA APVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLK PEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGS DAY
Protein Familie	OmpA family
Citations	"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Outer membrane protein II* (con) (tolG) (tut)
Lieferbar
Manufacturer - Targets	ompA
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	38.0 kDa
General Research Areas	Metabolism
Relevance	Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes.
Expression Region	22-346aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes.
Subcellular Location	Cell outer membrane, Multi-pass membrane protein
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern