« Zurück
Startseite /
Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial

Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial

ArtNr	CSB-EP002874HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETME LKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSI LRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFY EKALVELKVAALGSNLHVEVKGYEDGGIHLECRST GWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEV AASVIMRGGSGEGVSCIIRNSLLGLEKTASISIAD PFFRSAQPW
Protein Familie	Immunoglobulin superfamily, BTN/MOG family
Citations	The molecular basis for modulation of human Vgamma9Vdelta2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.Palakodeti A., Sandstrom A., Sundaresan L., Harly C., Nedellec S., Olive D., Scotet E., Bonneville M., Adams E.J.J. Biol. Chem. 287:32780-32790(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.6 kDa
General Research Areas	Immunology
Relevance	Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Expression Region	30-248aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Detected in T-cells and natural killer cells.
Gene Names	BTN3A2
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP002874HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern