« Zurück
Startseite /
Recombinant Human M-phase inducer phosphatase 3(CDC25C)

Recombinant Human M-phase inducer phosphatase 3(CDC25C)

ArtNr	CSB-EP004996HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLER DTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKR CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQ EVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPK LDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKY FSG
Protein Familie	MPI phosphatase family
Citations	An additional transcript of the cdc25C gene from A431 cells encodes a functional protein.Bureik M., Rief N., Drescher R., Jungbluth A., Montenarh M., Wagner P.Int. J. Oncol. 17:1251-1258(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dual specificity phosphatase Cdc25C
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.4 kDa
General Research Areas	Cell Biology
Relevance	Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Expression Region	1-473aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
Subcellular Location	Nucleus
Paythway	Cellcycle
Gene Names	CDC25C
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP004996HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern